PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G32730.1
Common NameATMYB3R1, ATMYB3R-1, F4D11.70, MYB3R1, MYB3R-1, PC-MYB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 776aa    MW: 86506.1 Da    PI: 5.3906
Description Homeodomain-like protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G32730.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-183581148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
      AT4G32730.1 35 KGQWTPEEDEVLCKAVERFQGKNWKKIAECFK-DRTDVQCLHRWQKVL 81
                     799****************************9.************986 PP

2Myb_DNA-binding62.58.7e-2087133148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd  ++d+v+++G++ W+tI+++++ gR +kqc++rw+++l
      AT4G32730.1  87 KGPWSKEEDNTIIDLVEKYGPKKWSTISQHLP-GRIGKQCRERWHNHL 133
                      79******************************.*************97 PP

3Myb_DNA-binding53.36.4e-17139181145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+  ++ ++ gR+++++k++w+
      AT4G32730.1 139 KNAWTQEEELTLIRAHQIYGNK-WAELMKFLP-GRSDNSIKNHWN 181
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5233081IPR017930Myb domain
SuperFamilySSF466896.39E-163288IPR009057Homeodomain-like
SMARTSM007171.3E-143483IPR001005SANT/Myb domain
PfamPF002494.0E-153581IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-223693IPR009057Homeodomain-like
CDDcd001671.59E-133881No hitNo description
PROSITE profilePS5129432.5882137IPR017930Myb domain
SuperFamilySSF466893.63E-3184180IPR009057Homeodomain-like
SMARTSM007171.9E-1886135IPR001005SANT/Myb domain
PfamPF002492.1E-1887133IPR001005SANT/Myb domain
CDDcd001672.57E-1689133No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2794140IPR009057Homeodomain-like
PROSITE profilePS5129418.286138188IPR017930Myb domain
SMARTSM007176.2E-15138186IPR001005SANT/Myb domain
PfamPF002499.5E-15139182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-22141188IPR009057Homeodomain-like
CDDcd001672.29E-11141181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0003011anatomyroot vascular system
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020132anatomycolumella root cap cell
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 776 aa     Download sequence    Send to blast
MKREMKAPTT PLESLQGDLK GKQGRTSGPA RRSTKGQWTP EEDEVLCKAV ERFQGKNWKK  60
IAECFKDRTD VQCLHRWQKV LNPELVKGPW SKEEDNTIID LVEKYGPKKW STISQHLPGR  120
IGKQCRERWH NHLNPGINKN AWTQEEELTL IRAHQIYGNK WAELMKFLPG RSDNSIKNHW  180
NSSVKKKLDS YYASGLLDQC QSSPLIALQN KSIASSSSWM HSNGDEGSSR PGVDAEESEC  240
SQASTVFSQS TNDLQDEVQR GNEEYYMPEF HSGTEQQISN AASHAEPYYP SFKDVKIVVP  300
EISCETECSK KFQNLNCSHE LRTTTATEDQ LPGVSNDAKQ DRGLELLTHN MDNGGKNQAL  360
QQDFQSSVRL SDQPFLSNSD TDPEAQTLIT DEECCRVLFP DNMKDSSTSS GEQGRNMVDP  420
QNGKGSLCSQ AAETHAHETG KVPALPWHPS SSEGLAGHNC VPLLDSDLKD SLLPRNDSNA  480
PIQGCRLFGA TELECKTDTN DGFIDTYGHV TSHGNDDNGG FPEQQGLSYI PKDSLKLVPL  540
NSFSSPSRVN KIYFPIDDKP AEKDKGALCY EPPRFPSADI PFFSCDLVPS NSDLRQEYSP  600
FGIRQLMISS MNCTTPLRLW DSPCHDRSPD VMLNDTAKSF SGAPSILKKR HRDLLSPVLD  660
RRKDKKLKRA ATSSLANDFS RLDVMLDEGD DCMTSRPSES PEDKNICASP SIARDNRNCA  720
SARLYQEMIP IDEEPKETLE SGGVTSMQNE NGCNDGGASA KNVSPSLSLH IIWYQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-67351886159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-67351886159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1659666DRRKDKKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.22350.0root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible253451_at0.0
Expression AtlasAT4G32730-
AtGenExpressAT4G32730-
ATTED-IIAT4G32730-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed ubiquitously at low levels. {ECO:0000269|PubMed:10743663}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative c-myb-like transcription factor with three MYB repeats.
Function -- GeneRIF ? help Back to Top
  1. Our results suggest that a pair of structurally related myb3r1 myb3r4 transcription factors may positively regulate cytokinesis mainly through transcriptional activation of the KN gene.
    [PMID: 17287251]
  2. MYB3R1 and MYB3R4 may have diverse roles during plant development by regulating G2/M-specific genes with various functions as well as genes possibly unrelated to the cell cycle.
    [PMID: 21862669]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G32730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G08560(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G32730
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1516460.0AF151646.1 Arabidopsis thaliana PC-MYB1 (PC-MYB1) mRNA, complete cds.
GenBankAF1760050.0AF176005.2 Arabidopsis thaliana putative c-myb-like transcription factor (AtMYB3R-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194999.10.0myb-related protein 3R-1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLF4JV480.0F4JV48_ARATH; Myb-related protein 3R-1
STRINGAT4G32730.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Braun EL,Grotewold E
    Newly discovered plant c-myb-like genes rewrite the evolution of the plant myb gene family.
    Plant Physiol., 1999. 121(1): p. 21-4
    [PMID:10482656]
  2. Kranz H,Scholz K,Weisshaar B
    c-MYB oncogene-like genes encoding three MYB repeats occur in all major plant lineages.
    Plant J., 2000. 21(2): p. 231-5
    [PMID:10743663]
  3. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  4. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  5. Jiang C,Gu X,Peterson T
    Identification of conserved gene structures and carboxy-terminal motifs in the Myb gene family of Arabidopsis and Oryza sativa L. ssp. indica.
    Genome Biol., 2004. 5(7): p. R46
    [PMID:15239831]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Haga N, et al.
    R1R2R3-Myb proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana.
    Development, 2007. 134(6): p. 1101-10
    [PMID:17287251]
  8. Ma Q, et al.
    Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is mediated by alteration in cell cycle and ectopic expression of stress genes.
    Plant Physiol., 2009. 150(1): p. 244-56
    [PMID:19279197]
  9. Haga N, et al.
    Mutations in MYB3R1 and MYB3R4 cause pleiotropic developmental defects and preferential down-regulation of multiple G2/M-specific genes in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 706-17
    [PMID:21862669]
  10. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]